PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009776472.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ZF-HD
Protein Properties Length: 1047aa    MW: 115982 Da    PI: 6.4677
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009776472.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer98.35.7e-31812867359
     ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                     ++rY eClkNhAas+Ggha+DGCgEfmps g egt+ alkC AC+CHRnFHR++  +
  XP_009776472.1 812 SIRYMECLKNHAASMGGHAIDGCGEFMPS-GGEGTPGALKCEACNCHRNFHRKKIIN 867
                     789*************************9.8899*******************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF141115.7E-91595IPR025558Domain of unknown function DUF4283
PfamPF141111.9E-6310389IPR025558Domain of unknown function DUF4283
PfamPF047701.2E-28813864IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257745.0E-20814865IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.5E-28814864IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.382815864IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 1047 aa     Download sequence    Send to blast
MSRSNLFKMY WDAAAAKCRL TMVGKFFKRK PKMTAIRASF SAKYPLKDHV KIVSFDSLHV  60
FLDFTNEEDY DAIFFKETII VAGAQMEVFR WTPEFHGPFT KMKPDNHTAK VEGRDETLGI  120
MELDKNEHIG GGNEYGSKES EAAPKNTHIL EDGLYISDSV DCVPEATHSD SAERVASPVN  180
CSTATSEIQA SAETSCSGSS GLSFASDGIA GGIPSVMDDS SSMCSTDSMS FRGTYSNHNI  240
QKLYGRGWKY GSKSTSNAAD WASEKLNQPL DALPIGEHHE DRKSRPPIQV QYSTYRGRQA  300
VTFPENYWES LVPDCKLTLI GNFFQRKPRM KEIRADFIAK NPLKGQVKIT HYTSQQVSLD  360
FTNEADYDTV LSKKTLTVAV MQISWWSRDI HHEVGKQEWK AMDKERDVKP GIMEQQKTEL  420
DELIGGETEY KIDAPEAVLE TPDILGEVSD VSNSLHIVPE VAHPDFRDND ASPVNCDTDT  480
SKMHPSIGIT CCQLSGISAP QNMIDGTSPY VMNVNSSKCS TYSILSIVTT GLSSNDKDQS  540
KSIRDVADSA SKAHSQPLDD LPEARQQMLK KDVAVSHQSE LTESDRERHS SEIPSVSSPP  600
RSPPRSIGSV IQLMSKLKVS VTNDPNSVKR STSDNSNLTQ KSVPLFNSAE NAVLLSVDPH  660
KSIEPKAIEK PLVRSISITT ENFPSNQVTA SATAEMPMPL LPTLPLLAHS VSPAAQLCAD  720
PPTAIDTYVP QSYPNGIVGS HIFGRSEQAG SGSIFPSPSQ ALHQHSLAQR HSQLNSYKVD  780
KNAHLDQESN MIAGPTQLQS LLTTSVSDTT SSIRYMECLK NHAASMGGHA IDGCGEFMPS  840
GGEGTPGALK CEACNCHRNF HRKKIINHRQ MAGIGSHIEP RNNSNSRNIH KQSPISQQYQ  900
HNYSYSPSSV VNSSDSYPQL PLPISGQICL PQGLEKKEPS LIRPSYSYEM VNHDTVQQWE  960
YFWRDRSRNT SIDHPSLRNE NQNFDMFKPL NYRTSDNIPS EFANEFPHLD IINNLRYDEH  1020
GKGRTLMPNS GFQNLSNGSY HLNGHFT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009776472.10.0PREDICTED: uncharacterized protein LOC104226233 isoform X1
TrEMBLA0A0V0ISQ51e-166A0A0V0ISQ5_SOLCH; Putative ovule protein
TrEMBLA0A0V0IT951e-167A0A0V0IT95_SOLCH; Putative ovule protein
STRINGPGSC0003DMT4000442701e-166(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14101810
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02540.17e-23homeobox protein 21